<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03-0381 03-0381 Cambodia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219R K103N P225H V35T, T39K, K43E, K122E, D123S, I135L, I142T, K173I, Q174K, D177E, I178M, Q207A, R211S, L228R, K238R  
>03-0381| codons 16-239
MDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSL
NNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVIYQYVDDLYVGSDLEI
GQHRTKIEELRAHLLSWGFTTPDRKHQKEHPFRWMGYELHPDRW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013