<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03-0243 03-0243 Cambodia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K101EQ, V106M, G190A   V35K, T39E, K122E, D123S, I135T, S162C, K173I, Q174K, V179I, Q207E, F214L, K238R  
>03-0243| codons 16-239
MDGPKVKQWPLTEEKIKALKEICEEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLQKKKSMTVLDVGDAYFSVPLDESFRKYTAFTIPST
NNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPDIIIYQYVDDLYVASDLEI
GQHRTKIEELREHLLRWGLFTPDQKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013