<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T0728211 T0728211 Cambodia 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E Y181C   V35T, K49R, V60I, K122E, D123S, I135T, K166R, K173I, Q174K, D177E, V179I, G196E, Q207S, R211S  
>T0728211| codons 17-239
DGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPIFAIKKKNSTRWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEIIICQYVDDLYVGSDLEIE
QHRTKIEELRSHLLSWGFTTPDEKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013