<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E   V108VI K20R, V35T, T39N, T69TA, S117SA, K122E, D123NS, T139K, S162F, K173IV, Q174K, D177E, I178M, V179I, G196E, Q207A, R211S, L228H P150PT, E203N
>U0114215| codons 17-239
DGPRVKQWPLTEEKIKALTEICNELEKEGKISKIGPENPYNTPVFAIKKKNSARWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFAVPLDESFRKYTAFTIPSIN
NEKPGIRYQYNVLTQGWKGSPAIFQFSMTKILEPFRVKNPEMIIYQYVDDLYVGSDLEIE
QHRTKINELRAHLLSWGFFTPDEKHQKEPPFHWMGYELHPDKW

References
Author Title Citation
Nouhin, J Increased risk of Q151M and K65R mutations in patients failing stavudine-containing first-line antiretroviral therapy in Cambodia. PLoS ONE, 2013