<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V   L10I, I13A, K14R, K20I, M36I, R41K, K43R, H69K, K70R, A71I, P79S, L89T, Q92K, I93M  
>CR-34| codons 1-99
PQITLWQRPIVTARIGGQLIEALLDTGADDTVLEEINLPGKWRPKIIGGIGGFVKVRQYD
QILIEICGKRIIGTVLVGSTPVNVIGRNTLTKMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215Y   L100I, K103N   E6EK, V35T, T39TA, K43KN, E44ED, K49R, V118I, K122P, S162DN, K173T, Q174K, D177E, T200A, Q207E, P243PA, V245T, E248ED, S251SN, T286A, E291D, V292I, I293V, P294T, S322A  
>CR-34| codons 1-333
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELENDGKISRIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQAITLPDKDNWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQG

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011