<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F K219Q K103RS, Y181C, G190A V108VI V35T, E36ED, T69N, K101Q, S162AT, K173T, Q174K, D177E, I178M, T200A, Q207E, R211Q, L228R, V245Q, E248D, T286A, E291D, V292I, I293V, P294T, S322T, I326V  
>CR-48| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKSKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRTKNPEMVI
CQYVDDLYVASDLEIGQHRAKIEELREHLLQWGFFTPDQKHQKEPPFRWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, N37I_D, I64L, H69K, K70E, L89M M36K
>CR-48| codons 2-99
QITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEKILPGRWKPKMIGGIGGFIKVRQYDQ
ILLEICGKEAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011