<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR-46 CR-46 Cameroon 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L76LV, I84IV   L10LV, I13V, K14KR, K20I, M36I, R41K, D60DE, L63LP, H69K, A71AV, L89MT  
>CR-46| codons 1-99
PQITLWQRPVVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYE
QIPIEICGKKVIGTVVVGPTPVNVIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K11T, V35T, T39L, D123S, S162A, Q174E, D177E, T200A, Q207E, V245K, K277R, T286A, E291D, V292I, I293V, P294T, S322A  
>CR-46| codons 1-334
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICLELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKENPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQ

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011