<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70N, V75I, F77L, F116Y K101E, Y188L   K11T, E28K, K32E, V35T, T58N, S68G, V106I, D121DY, K122E, D123G, I135T, S162C, T165I, E169K, K173A, Q174K, D177E, V179I, G196E, T200A, I202V, Q207A, R211ST, F214L, V245Q, D250E, I293V, P294T, E297K, K311KR  
>CR-49| codons 1-334
PISPIETVPVTLKPGMDGPKVKQWPLTKEKIEALTEICTEMEKEGKISKIGPENPYNNPV
FVIKKKDGTNWRKLIDLRELNKRTQDFWEVQLGIPHPAGLEKKKSITVLDVGDAFYSVPL
YEGFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQCSMIKILKPFRAKNPEIII
YQYVDDLLVGSDLEIEQHRAKVEELRAHLLTWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVTLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, V82AT Q58E, L89V L10I, I13V, K14R, I15V, K20I, E35D, M36I, N37D, R41RK, K55R, I62V, L63P, A71V, I72KT  
>CR-49| codons 1-99
PQITLWQRPIVTVRVGGQLIEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFIRVREYD
QVPIEICGHKVTGTVVVGPTPTNIIGRNVLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011