<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, K14R, I15V, G17D, E35D, M36I, R41K, R57K, D60E, Q61N, I62V, L63LP, I93L  
>CR-47| codons 2-99
QITLWQRPIVTIRVGDQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYEN
VPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N A98G, V108I K20R, V35I, T39A, E44D, V60I, V118I, K122E, I135IMT, I142T, D177E, I178L, E203EK, Q207E, H208HY, R211RK, K223KE, L228LH, V245T, D250E, A272P, K277R, T286A, V292I  
>CR-47| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPI
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011