<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E K20KR, V35Q, V60I, K102E, K122E, D123S, E138A, I142IV, A158AS, S162SACG, T165TI, K173A, Q174K, D177E, I178MV, T200A, Q207D, V245K, T286A, E291D, V292I, I293V, P294T, S322A  
>CR-8| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALQEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPSIFQGSMIKILEPFRAKNPEVEI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, L19P, K20I, M36I, N37S, R41K, H69K, L89M  
>CR-8| codons 1-99
PQITLWQRPVVTVKIGGQPIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011