<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N, T69~, Q151M V75VI, F77L, K219E K103KN, Y181C, G190A F227FL, K238T L34I, V35T, T39M, E40D, S68G, K101Q, K122E, I135IM, S162A, R172K, K173A, Q174K, N175Y, D177E, T200E, K201R, E203Q, Q207DN, F214L, K223EQ, L228LR, V245E, K249KR, T286A, E291D, I293V, P294T, S322A  
>CR-31| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICMDMEKEGKISKIGPENPYNTPV
FAIKRKNG~KWRKLIDLRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFKAKYPEIVI
CQYMDDLYVASDLEIGQHRERIQELRNHLLRWGLTTPDEKHQQEPPLRWMGYELHPDTWT
VQPIELPERDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, H69K, L89M  
>CR-31| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011