<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F L10F I13V, K14R, I15V, K20I, E35D, M36I, N37D, R41K, L63T, H69K, T74TA, L89M, I93M  
>CR-43| codons 2-99
QITLWQRPFVTVRVGGQLIEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFIKVRQYDQ
ITIEICGKKAIGAVLVGPTPFNIIGRNMLTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, T215I, K219E Y181V   K11T, V35T, T39L, S48T, V60I, S68G, D121H, K122E, I135T, E169D, K173A, Q174K, D177E, V179I, G196E, I202V, Q207V, R211S, F214FL, V245E, E291D, I293V H208N, E312Y
>CR-43| codons 1-334
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKITKIGPENPYNTPI
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPEIII
VQYVDDLYVGSDLEIEQHRTKVEELRVNLLSWGLITPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKYPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011