<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V V75T Y181I   K20KR, V35T, E36D, T39L, T69N, K122I, I132L, S162A, K173T, Q174K, D177E, V179VIM, G196E, T200E, E203Q, Q207E, F214L, H221Y, V245Q, E248N, D250E, S251SC, T286A, I293V, P294T, S322T F61L
>CR-29| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICLEMEKEGKISKIGPENPYNTPV
LAIKKKDSNKWRKVTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSVPL
DIDFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIMI
IQYVDDLYVGSDLEIEQHREKIQELREHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPNKECWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TI, I13V, G16E, K20I, M36I, R41K, I64IM, H69K, K70R, L89M  
>CR-29| codons 1-99
PQITLWQRPLVIVKIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011