<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74V, M184V, T215CF D67G, K219Q Y181C   V35T, T39M, K46Q, K49R, S68G, S105A, D123E, T139K, K173A, Q174K, N175NY, D177E, I202V, Q207E, R211K, F214L, V245Q, E248D, D250T, A272P, K275R, Q278H, T286A, E291D, V292I, I293V, E297A  
>CR-51| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGQISRIGPENPYNTPV
FAIKKKGGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKAVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKYPEIVI
CQYVDDLYVGSDLEIGQHRTKVEELREHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKTSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L24I, L33F, Q58E L10I, I13V, K14R, I15IV, G16E, K20R, E35D, M36I, P39Q, R41K, K55R, I62V, L63ST, H69K, L89M  
>CR-51| codons 1-99
PQITLWQRPIVTVRVEGQLREALIDTGADDTVFEDINLQGKWKPKIIGGIGGFVRVREYD
QVTIEICGKKAIGTVVVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011