<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215TNSY   K103N A98G T27S, V35T, T39R, K43E, S68G, D121Y, K122E, D123G, I135T, K173A, Q174K, D177E, G196E, T200A, Q207A, R211S, V245Q, D250E, A272P, T286A, E291D, I293V G285GR
>CR-26| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICRELEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIEQHRAKIEELRAHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRRAKALTDVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20IV, E35DN, M36I, R41K, K43KR, L63P, H69Q, I72V, V77VI, L89M  
>CR-26| codons 2-99
QITLWQRPIVTVKIGGQLVEALLDTGADDTVLENINLPGKWRPKMIGGIGGFIKVRQYDQ
IPIEICGQKAVGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Charpentier, C Virological failure and HIV type 1 drug resistance profiles among patients followed-up in private sector, Douala, Cameroon. ARHR, 2011