<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU525-11 CU525-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, P39S, L63H, I64V, V77I, I93L  
>CU525-11| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYD
QIHVEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E40D, K49R, I135T, E169D, I178L, G196E, Q207E, F214L, V245Q, A272P, V276I, I293V, E297A, K311R, V317VA, I329L, G335N  
>CU525-11| codons 1-341
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
YQYMDDLYVGSDLEIEQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKALTEVVPLTAEAE
LELAENREILREPVHGAYYDPSKDLIAELQKQGQNQWTYQI

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012