<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1549-10 CU1549-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y188L   K11N, T69N, D121HY, K122E, S162C, D177E, V245Q, E248T, A272P, K277R, I293V, T296S, E297T, I329V W266G
>CU1549-10| codons 1-335
PISPIETVPVNLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPTKDSWTVNDIQKLVGKLNGASQIYPGIKVRQLCKLLRGTKALTEVVPLSTEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, E35N, M36I, H69K, K70R, V82I, L89M T96TI
>CU1549-10| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLENINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCILNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012