<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1650-09 CU1650-09 Cuba 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F, L90M K43T L10I, M36V, R41K, I62V, L63P, I64V, I93L P9R
>CU1650-09| codons 3-99
ITLWQRRIVTIKIGGQLKEALLDTGADDTVLEEVNLPGKWTPKMIGGIGGFIKVRQYDQV
PVEICGHKAIGTVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V   L100I, K103KN P225H V35R, S48T, S68G, K173E, Q174K, V179I, R211S, W212G, A272P, V292I, I293IV, G335S K154N
>CU1650-09| codons 1-343
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTELEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWNGSPAIFQSSMTKILEPFREKNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLSGGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQSQWTYQIYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012