<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, L74I, Y115YF, Q151M V75I, F116Y, K219E K103N, Y181YC V108I V60I, S68G, T69I, R83K, V111VI, K122E, I135IL, D177E, I178L, F214FL, L228R, V245E, T286A, I293V, E297A, V317A, G335GA G112S, Y342YN
>CU2035-10| codons 1-342
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDGIRWRKIIDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTILDISDAFYSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPELVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDEKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQAQWTYQIN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I84V, L90M L33F, Q58E, G73S L10I, I13V, I15V, K20KR, M36MI, L63P, A71V  
>CU2035-10| codons 1-99
PQITLWQRPIVTVKVGGQLREALLDTGADDTIFEEINLPGRWKPKMIGGIGGFIKVREYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012