<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU599-11 CU599-11 Cuba 2011 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40ED, K49R, V60I, K122E, K173L, Q174K, D177E, V179I, I202V, Q207A, R211T, V245S, D250E, A272P, K277R, T286A, I293V, P294T, S322T, A327T, G335D  
>CU599-11| codons 1-338
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPISLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLITEIQKQGQDQWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, K14R, I15V, K20R, E35D, M36I, R41K, R57K, L63APT, H69K, L89M  
>CU599-11| codons 1-99
PQITLWQRPLVTVRVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012