<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W K219R K103N A98G K43Q, V118I, K122E, D123S, I142V, D177G, H208Y, R211K, K223Q, L228H, Q242H, V245Q, E248D, A272P, K277R, I293V, E297A, G333E N137S
>CU330-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINSETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFTTPDRKHQQEPPFHWMGYELHPDKWT
VHPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, G48M, I54V, V82T, I84V L33I, L89V L10I, I13A, K20V, A22V, M36I, R41K, K43I, I62IV, I66F, G68D, H69K, A71V, T91S E35HN
>CU330-10| codons 1-99
PQITLWQRPIVTAKIGGQLVEVLLDTGADDTVIENINLPGKWIPKIVMGIGGFVKVRQYD
QVLIEFCDKKVIGTVLVGPTPTNVIGRNVLSQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012