<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU221-10 CU221-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75I, K219Q   K238T I31L, T39A, K43Q, K49R, A98S, V118I, K122E, E169D, I202IV, H208Y, R211K, V245E, E248D, P294T, K311KR  
>CU221-10| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICAELEQEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQYLWKWGFYTPDQKHQKEPPFLWMGYELHPDTWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVITLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, E35D, M36I, K45R, R57K, L63P, A71T, I72T  
>CU221-10| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPRMIGGIGGFIKVKQYD
QIPIEICGHKTTGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012