<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU694-11 CU694-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, I15IV, K20KR, E35D, N37RS, R41KN, L63LP, H69Q, I72IV, V77VI, L89M, I93IL  
>CU694-11| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVLEDMSLPGNWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8VI, K32E, V35T, E36A, T39D, S48T, V60I, K122E, D123NS, I135R, K166R, Q197L, T200AE, I244V, V245Q, A272P, T286A, E291D, V292I, P294T  
>CU694-11| codons 1-340
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIEALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGLHREKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIITLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012