<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L76V, V82A L10F, L24I, L33F I13V, N37S, R41K, L63P, H69K, A71V, L89M, I93L  
>CU1124-09| codons 1-99
PQITLWQRPFVTVKIGGQLKEALIDTGADDTVFEEMSLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGKKVIGTVVVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y V75M K101E, Y181C, G190A A98G, P225H V35K, T39D, V118VM, K122E, D123S, I135T, K173T, D177E, T200A, Q207KR, R211Q, L228R, V245Q, A272P, E291D, V292I, I326V, Q334D, G335D V111VM
>CU1124-09| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICDELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDMGDAYFSMPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
CQYVDDLYVASDLEIGQHRAKIEELRRHLLQWGFYTPDKKHQKEHPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGDDQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012