<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1167 CA2652 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 52
2 None 126
3 3TC+AZT 22
4 3TC+AZT+NVP 26
5 3TC+D4T+NFV+NVP 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   E35D, N37E, L63P, A71T, V77I Q2Q*, G17GW
>CA2652| codons 1-99
P*ITLWQRPLVTIKIGWQLKEALLDTGADNTVLEDMELPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, M184V, T215Y D67G, V75M, F77L K101E, G190A   A98S, A158S  
>CA2651| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKGSDRWRKLMDLRELNKRTQDFWEVQLGIPHPSGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LEL

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005