<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU121-11 CU121-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TI, K219Q     E28A, K49R, T69TN, A98S, V118VI, D123E, I135T, E169D, I178L, V179VI, G196E, T200TA, E204K, Q207E, F214L, V245M, A288S, I329L  
>CU121-11| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLII
YQYVDDLYVGSDLEIEQHRAKIEKLREHLLRWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82A, L90M L89LV L10I, I13V, Q18H, K20M, E35D, M36MI, R41K, K45R, L63P, A71V, I93L, C95F  
>CU121-11| codons 1-99
PQITLWQRPIVTVKIGGHLMEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNVMTQLGFTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012