<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU860-10 CU860-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70KR, M184V, T215TFIS V75I Y181C   K20R, I31L, K49R, D123E, I135R, E169D, D177E, V179I, G196E, T200A, Q207AE, R211K, F214L, D218E, E297A, I326V, I329L  
>CU860-10| codons 1-340
PISPIETVPVKLKPGMDGPRVKQWPLTEEKLKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKDSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIII
CQYVDDLYVGSDLEIEQHRAKIEELREHLLKWGLSTPEKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAELQKQGQGQWTYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, L63P, V77I  
>CU860-10| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012