<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V L33F, F53L, Q58E, L89V L10I, T12E, I13AV, K14R, I15V, G16Q, K20V, E35G, M36I, P39S, R41RK, D60DN, I64V, I66F, H69K, K70E, A71V, I93IV  
>CU1213-09| codons 1-99
PQITLWQRPIVEVRVQGQLVEALLDTGADDTIFEGINLSGKWKPKIVGGIGGLLKVREYN
QILVEFCGKEVIGTVLVGPTPVNVIGRNVLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y     V108I T7P, K20R, V35I, E44D, V118I, D121A, K122E, I135T, S162C, P170PS, K173T, Q174K, N175Y, D177E, V189I, G196E, T200A, E203K, Q207D, H208Y, R211N, H221Y, V245Q, E248D, D250E, A272S, K275R, T286A, V292I, E297A, V317A, Q340H, F346H  
>CU1213-09| codons 1-348
PISPIEPVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
AEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILESFRTKYPEIVI
YQYVDDLYIGSDLEIEQHRAKIKELRDYLWNWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYSGIRVKQLCKLLRGAKALTEIIPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYHIYQEPHKN

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012