<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   I15V, M36I, R41K, H69K, L89M, I93L  
>CU1893-09| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKLIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, Y181YC   V35T, E36A, T39E, K122E, D123S, I135T, K173T, Q174K, D177E, T200A, Q207E, R211K, F214L, H221HY, V241I, V245Q, D250E, A272P, E291D, V292I, I293V, A304E, Q334H, G335D L92LF, Q145QL
>CU1893-09| codons 1-341
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQFGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYLYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
IQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELEENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQI

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012