<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1651-09 CU1651-09 Cuba 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F E35D, K43KR, R57K, L63P, A71V, V77VI, I93L  
>CU1651-09| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWRPKMIGGIGGFIKVKQYD
QIPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11R, K20R, D123E, S162C, I178IM, E204D, Q207A, R211K, A272P, T286TA, I293V, E297K, E312T, Q334L, F346Y K49KN
>CU1651-09| codons 1-348
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISNIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEDLRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKTPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPYKN

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012