<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1209-09 CU1209-09 Cuba 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, V82A L10F, L24I, L33F, Q58E I13V, K20R, M36I, R41K, K43KR, I62V, L63P, E65ED, A71V  
>CU1209-09| codons 1-99
PQITLWQRPFVTVKIGGQLREALIDTGADDTVFEEINLPGKWRPKLIGGIGGFMKVREYD
QVPIDICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y V75M V106M, G190A A98G V35T, T39A, K43E, E44D, V60I, K102KN, D121H, K122E, I135IL, D177E, I178L, V179I, G196E, T200A, I202V, E203D, E204A, Q207E, L210S, H221Y, V245T, D250E, A272S, K277R, T286A, E297K, P313S, V317A, I329V, G335D, E344D L12L*, Q23Q*, P97PR, L109W
>CU1209-09| codons 1-348
PISPIETVPVK*KPGMDGPKVK*WPLTEEKIKALTEICAELEEDGKISKIGPENPYNTPI
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHRGGLKNKKSMTVWDVGDAYFSVPL
HEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELII
YQYVDDLYVASDLEIEQHRAKVDALREHLSRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKESVHGAYYDPSKDLIAEVQKQGQDQWTYQIYQDPFKN

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012