<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1907-09 CU1907-09 Cuba 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, Y115F, M184V, T215F       I31IL, T39A, V118I, K122E, D123N, K173Q, D177E, V179I, Q197K, T200A, R211K, V245Q, E248ED, A272P, T286A, V292I, E297A, P321S, G335D  
>CU1907-09| codons 1-341
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPEIII
YQYVDDLYVGSDLEIGKHRAKIEELRQHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIIPLTAEAE
LELAENREILKEPVHGVYYDSSKDLIAEIQKQGQDQWTYQI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20I, E35D, M36I, R41K, C67HY, H69K, V82I, L89M  
>CU1907-09| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIYGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012