<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU407-10 CU407-10 Cuba 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20I, E35DN, M36I, R41K, H69K, L89M  
>CU407-10| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A K101H G45GE, I142T, S162C, E169D, R172K, I178V, T200A, R211K, F214FL, A272P, T286A, V292I, E297A, I326IM, I329L  
>CU407-10| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEEKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQCSMTKILDPFKKQNPDVVI
YQYMDDLYVASDLEIGQHRAKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLMAELQKQGQGQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012