<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, I15V, G16E, N37NS, P39S, I62IV, L63H, I64IV, L89LM, I93IL  
>CU482-10| codons 1-99
PQITLWQRPLVTVKVEGQLKEALLDTGADDTVLEEMSLSGRWKPKMIGGIGGFIKVRQYD
QVHVEICGHKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184MV K219Q G190A   V35VA, E36EA, K49R, K64R, K122KE, D123E, I135IT, E169ED, I178IF, V179VI, G196E, T200A, Q207E, H208HY, F214L, L228R, V245KQ, A272P, R284K, V292VL, I293V, E297A, I329L V254VI
>CU482-10| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAAICTEMEKEGKISRIGPENPYNTPV
FAIRKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDFII
YQYVDDLYVASDLEIEQHRAKIEELREYLLRWGLTTPDQKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTINDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKALTELVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQG

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012