<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU2040-09 CU2040-09 Cuba 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I50V, I54V F53L L10I, I13V, G16E, K20I, E35N, M36MV, N37S, R41K, I66F, H69K, K70R, T74S, V82I, L89M  
>CU2040-09| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLENVSLPGKWKPKIVGGVGGLVKVRQYD
QILIEFCGKRAIGSVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K122P, I135T, S162C, D177G, R211K, V245Q, E248D, A272P, K277R, R284RK, I293V, E297A, S322A, G335D Q340QE
>CU2040-09| codons 1-341
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLKGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYEI

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012