<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1289-09 CU1289-09 Cuba 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F G16A, I62IV, L63P, A71V, P79HQ, Q92K  
>CU1289-09| codons 1-99
PQITLWQRPFVTIKIAGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGQTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   Y181C   V35M, T39A, K43E, K122E, D123E, I135T, R211K, E224D, V241VL, V245K, T286A, I293V, E297Q, E312Q, D324E  
>CU1289-09| codons 1-348
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKDPPFLWMGYELHPDKWT
LQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTQEAE
LELAENREILKQPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKN

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012