<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU783-10 CU783-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, A98S, V106I, D123E, E169D, I178L, Q197R, T200AV, Q207D, R211K, F214L, K238R, V245M, A272P, K277R, L310LI, I329L, Q334E  
>CU783-10| codons 1-348
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
YQYMDDLYVGSDLEIGRHRVKIEELRDHLLKWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREIIKEPVHGVYYDPSKDLIAELQKQGEGQWTYQIYQEPFKN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I, Q58E I13V, M36T, P39S, R57K, I62V, L63P, I64V  
>CU783-10| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVIEETNLSGRWKPKMIGGIGGFIKVKEYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012