<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106A F227L V35T, T39A, E40D, K49R, K122E, I135R, E169D, D177E, Q197K, T200A, I202V, Q207E, R211K, F214L, P243S, V245T, D250E, N255ND, A272S, E297K, P313Q, I329V, Q334P V254I, L264N, N265K, A327E
>CU163-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGKHRAKVEELREHLLKWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQSITLPEKESWTIDDIQKLVGKNKWASQIYSGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEQVHGVYYDPSKDLIEEVQKQGPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2H, L10V, I13V, E35D, M36I, R41K, K45R, R57K, D60E, L63P, H69Q, V77I  
>CU163-10| codons 1-99
PHITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYE
QIPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012