<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1876-10 CU1876-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, M36I, N37NS, P39PS, Q61QH, I62V, L63H, H69Q, K70E, I72V  
>CU1876-10| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEEISLSGRWKPKMIGGIGGFIKVRQYD
HVHIEICGQEAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, E28A, K43KN, E44ED, K49R, I50IV, A98S, D123E, I135T, E169D, D177E, I178L, I202V, Q207E, F214L, V245M, A272P, I329L  
>CU1876-10| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTAEKIKALVEICTEMENDGKISRVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKVEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQG

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012