<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU2011-10 CU2011-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, N37S, R57K, L63A, I72V, V77I  
>CU2011-10| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVKQYD
QIAIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181C   K49R, V118I, D123E, I135K, T139A, E169D, I178L, T200A, Q207E, R211K, F214L, L228LR, V245M, S251R, T286A, P294S, I329L  
>CU2011-10| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSKNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIMLPEKDRWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVISLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012