<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, T69D, K70R, M184V, T215F K219Q     K20R, V35VIM, K49R, V60I, V118I, K122E, D123EG, I135T, E169D, Q174R, D177E, I178L, V179I, Q207E, R211K, F214L, V245KM, A272P, A288T, I293V, E298EA, I329L, G335D Q91QH, W266WG
>CU1915-10| codons 1-348
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVHLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKRNPELII
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNGASQIYPGIKVKQLCKLLRGTKTLTEVVPLTEAAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQDQWTYQIYQEPFKN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47IV, G48V, I54M, L76V, V82A, L90M L33F, M46V L10I, I13V, G16GA, E34Q, N37DE, R41RK, K55R, R57K, L63P, I66V, A71V, V77I, I93L, C95F  
>CU1915-10| codons 1-99
PQITLWQRPIVTVKIAGQLKEALLDTGADDTVFQEMELPGKWKPKVVVGIGGFMRVKQYD
QIPIEVCGHKVIGTVVIGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012