<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU668-10 CU668-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V, T215AV Y181C V108I K102R, D121Y, K122E, I135T, S162SC, I202V, Q207H, R211K, H221HY, L228R, A272P, V276VI, T286A, E297AV, I326V S191T
>CU668-10| codons 1-338
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTILDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYVDDLYVGTDLEIGQHRTKVEELRHHLLKWGFVTPDKKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGAKALTEVIPLTVEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQGQWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6G, L10I, E35D, L38LI, L63P, I72V, I93L  
>CU668-10| codons 1-99
PQITLGQRPIVTIKIGGQLKEALLDTGADDTVLEDMNIPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012