<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU181-11 CU181-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y A62AV K101E, Y181YC, G190A   K122E, I135IT, E138Q, S162C, D177E, V179VL, Q197QK, R211K, V245Q, E248D, A272P, K277R, E297A, E312EG  
>CU181-11| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEILI
CQYVDDLYVASDLEIGKHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKGPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35N, M36I, R41K, R57K, I64IL, H69K, K70R, V82I, L89M  
>CU181-11| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVKQYD
QILLEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012