<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU40-11 CU40-11 Cuba 2011 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G17E, K20I, E35D, M36I, R41K, L63C, H69K, K70R, T74A, V82I, L89M  
>CU40-11| codons 1-99
PQITLWQRPIVTVRIGEQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKRAIGAVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, T39A, K122E, D123E, I135V, S162C, D177E, T200A, R211K, V245M, A272P, E297A  
>CU40-11| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012