<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, K43R, R57K, I62V, L63P, I64V, H69Q, A71T, V77I, I93L  
>CU116-10| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
QVPVEICGQKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, M184V T215TI, K219KE K103N P225H V21I, V35T, T39A, E40D, K101Q, K122KE, D177E, I178M, Q207T, V245T, D250E, A272S, T286A, V292I, P313T, V317A, I329V  
>CU116-10| codons 1-335
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRTHLLRWGFITPDEKHQKEHPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEIIPLTEEAE
LELAENREILKETVHGAYYDPSKDLIAEVQKQGQG

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012