<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU53-11 CU53-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, M184V, L210W, T215Y   K103N V108VI E28A, V35T, M41MI, E44ED, V90I, D123E, I135IT, S162Y, D177E, R211RK, K275R, T286A, I293V S3AT, N255NS, Y271YD, L279LV
>CU53-11| codons 1-334
PITPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICTEIEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVSDIQKLVGKLNWASQIDAGIRVKQVCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, M36MI, R57K, L63P, I64V, I72V  
>CU53-11| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012