<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1510-10 CU1510-10 Cuba 2010 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13V, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>CU1510-10| codons 1-99
PQITLWQRPLITVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E42ED, I135L, S162C, D177E, V189I, T200A, R211E, L228N, E248D, D250E, A272P, K277R, I293V, E297AT, I329V, Q343QR P52PT, E53EK, A62AD
>CU1510-10| codons 1-344
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMDKEGKISKIGTKNPYNTPV
FDIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYIGSDLEIGQHRAKIEELRQHLLEWGFTTPDKKHQKEPPFNWMGYELHPDKWT
VQPIVLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYRE

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012