<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU251-11 CU251-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, N37A, R41K, L63H, I64V  
>CU251-11| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMALPGKWKPKMIGGIGGFIKVRQYD
QIHVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, K122KE, D123E, I135T, E169D, D177E, I178L, T200A, Q207E, F214L, V245M, A288S, I329L, G335D  
>CU251-11| codons 1-338
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQDQWT

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012