<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, Q151M, M184V, T215F A62AV, V75IL, F77L K101E, Y181C, G190S   K49R, S68G, V118I, K122E, D123N, I135T, S162D, E169D, D177E, I178L, V189I, T200TA, I202IV, Q207E, F214L, V245M, A272P, V276T, E297K, I329L  
>CU606-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKKKDG~KWRKLLDLRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQDSMTKILDPFRKQNPELVI
CQYVDDLYISSDLEIGQHRAKVEELREHLLRWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V L10F, L33F I13V, K14R, P39Q, L63PT, K70T, T74S, P79S, L89M  
>CU606-10| codons 1-99
PQITLWQRPFVTVRIGGQLKEALLDTGADDTVFEEMNLQGRWKPKLIGGIGGFIKVRQYD
QITIEICGHTAIGSVLVGSTPVNVIGRNMLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012