<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU606-10 CU606-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V L10F, L33F I13V, K14R, P39Q, L63PT, K70T, T74S, P79S, L89M  
>CU606-10| codons 1-99
PQITLWQRPFVTVRIGGQLKEALLDTGADDTVFEEMNLQGRWKPKLIGGIGGFIKVRQYD
QITIEICGHTAIGSVLVGSTPVNVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, Q151M, M184V, T215F A62AV, V75IL, F77L K101E, Y181C, G190S   K49R, S68G, V118I, K122E, D123N, I135T, S162D, E169D, D177E, I178L, V189I, T200TA, I202IV, Q207E, F214L, V245M, A272P, V276T, E297K, I329L  
>CU606-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKKKDG~KWRKLLDLRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQDSMTKILDPFRKQNPELVI
CQYVDDLYISSDLEIGQHRAKVEELREHLLRWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012